PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G204200.1.p
Common NameSb07g027160, SORBIDRAFT_07g027160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 310aa    MW: 34078.4 Da    PI: 8.5962
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G204200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.11.5e-111762146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                          +g+WT+eEde l + v + G++ W++I ++  + Rt+k+c++rw +
  Sobic.007G204200.1.p 17 KGPWTAEEDEVLRRHVLENGPREWSSIRSKGLLPRTGKSCRLRWVN 62
                          79*************************8876677**********87 PP

2Myb_DNA-binding40.94.7e-1373113345
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           ++++eE+   +d+ +q+G++ W++Ia ++  gRt++++k++w 
  Sobic.007G204200.1.p  73 KFSAEEERVVIDLQAQFGNK-WARIATYLS-GRTDNDVKNFWS 113
                           79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.4011264IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-191565IPR009057Homeodomain-like
SuperFamilySSF466891.25E-2516112IPR009057Homeodomain-like
SMARTSM007179.0E-101666IPR001005SANT/Myb domain
CDDcd001671.53E-101964No hitNo description
PfamPF139212.8E-112070No hitNo description
PROSITE profilePS5129420.31665120IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-1866118IPR009057Homeodomain-like
SMARTSM007171.9E-1170118IPR001005SANT/Myb domain
PfamPF002491.1E-1073113IPR001005SANT/Myb domain
CDDcd001671.25E-973112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MKPGGGGGRE LSAWVRKGPW TAEEDEVLRR HVLENGPREW SSIRSKGLLP RTGKSCRLRW  60
VNKLRPDIKK GCKFSAEEER VVIDLQAQFG NKWARIATYL SGRTDNDVKN FWSTRQKRLA  120
RLLRAPAPRR RPRGSGRQSC GGASFSYARA SPAQKLQLLC QSPCQDMIPF VETKPQLLHT  180
GGQSSSRQED QEPGPRTVKA LAIALPTHYD SASEFGSSGA TPTAATRLLS FGDDARSPAS  240
GVDPLVFVDP DDDEAFCPEP LAVVPPSPFF GMDEEEYVHF GASMHQGVRF DDLTPETLDF  300
FGLPPSAQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-251511825126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002445870.10.0hypothetical protein SORBIDRAFT_07g027160
TrEMBLC5YIL50.0C5YIL5_SORBI; Putative uncharacterized protein Sb07g027160
STRINGSb07g027160.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.14e-57MYB family protein